Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of BTG4 monoclonal antibody (M07), clone 1A6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re,WB-Tr |
More info about BTG4 monoclonal antibody (M07), clone 1A6
| Brand: | Abnova |
| Reference: | H00054766-M07 |
| Product name: | BTG4 monoclonal antibody (M07), clone 1A6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant BTG4. |
| Clone: | 1A6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 54766 |
| Gene name: | BTG4 |
| Gene alias: | MGC33003|PC3B |
| Gene description: | B-cell translocation gene 4 |
| Genbank accession: | BC031045 |
| Immunogen: | BTG4 (AAH31045, 1 a.a. ~ 206 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MRDEIATTVFFVTRLVKKHDKLSKQQIEDFAEKLMTILFETYRSHWHSDCPSKGQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGRWEEWELYQQISYAVSRASSDVSSGTSCDEESCSKEPRVIPKVSNPKSIYQVKSVPVLFYTFFLSNSKKNALIMKTKKQKNMERTKL |
| Protein accession: | AAH31045 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (48.4 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of BTG4 expression in transfected 293T cell line by BTG4 monoclonal antibody (M07), clone 1A6. Lane 1: BTG4 transfected lysate(24 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |