BTG4 purified MaxPab mouse polyclonal antibody (B01P) View larger

BTG4 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BTG4 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about BTG4 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00054766-B01P
Product name: BTG4 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human BTG4 protein.
Gene id: 54766
Gene name: BTG4
Gene alias: MGC33003|PC3B
Gene description: B-cell translocation gene 4
Genbank accession: BC031045
Immunogen: BTG4 (AAH31045.1, 1 a.a. ~ 206 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRDEIATTVFFVTRLVKKHDKLSKQQIEDFAEKLMTILFETYRSHWHSDCPSKGQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGRWEEWELYQQISYAVSRASSDVSSGTSCDEESCSKEPRVIPKVSNPKSIYQVKSVPVLFYTFFLSNSKKNALIMKTKKQKNMERTKL
Protein accession: AAH31045.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00054766-B01P-13-15-1.jpg
Application image note: Western Blot analysis of BTG4 expression in transfected 293T cell line (H00054766-T01) by BTG4 MaxPab polyclonal antibody.

Lane 1: BTG4 transfected lysate(22.66 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy BTG4 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart