Brand: | Abnova |
Reference: | H00054763-M03 |
Product name: | ROPN1 monoclonal antibody (M03), clone 4E11 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ROPN1. |
Clone: | 4E11 |
Isotype: | IgG2a Kappa |
Gene id: | 54763 |
Gene name: | ROPN1 |
Gene alias: | DKFZp434B1222|ODF6|RHPNAP1|ROPN1A|ropporin |
Gene description: | ropporin, rhophilin associated protein 1 |
Genbank accession: | BC015413 |
Immunogen: | ROPN1 (AAH15413, 1 a.a. ~ 120 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE |
Protein accession: | AAH15413 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.94 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to ROPN1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Functional Expression of Ropporin in Human Testis and Ejaculated Spermatozoa.Chen J, Wang Y, Wei B, Lai Y, Yan Q, Gui Y, Cai Z. J Androl. 2010 Aug 12. [Epub ahead of print] |