Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ROPN1 monoclonal antibody (M03), clone 4E11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re |
More info about ROPN1 monoclonal antibody (M03), clone 4E11
| Brand: | Abnova |
| Reference: | H00054763-M03 |
| Product name: | ROPN1 monoclonal antibody (M03), clone 4E11 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant ROPN1. |
| Clone: | 4E11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 54763 |
| Gene name: | ROPN1 |
| Gene alias: | DKFZp434B1222|ODF6|RHPNAP1|ROPN1A|ropporin |
| Gene description: | ropporin, rhophilin associated protein 1 |
| Genbank accession: | BC015413 |
| Immunogen: | ROPN1 (AAH15413, 1 a.a. ~ 120 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE |
| Protein accession: | AAH15413 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.94 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to ROPN1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Functional Expression of Ropporin in Human Testis and Ejaculated Spermatozoa.Chen J, Wang Y, Wei B, Lai Y, Yan Q, Gui Y, Cai Z. J Androl. 2010 Aug 12. [Epub ahead of print] |