PCSK4 MaxPab mouse polyclonal antibody (B02) View larger

PCSK4 MaxPab mouse polyclonal antibody (B02)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCSK4 MaxPab mouse polyclonal antibody (B02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about PCSK4 MaxPab mouse polyclonal antibody (B02)

Brand: Abnova
Reference: H00054760-B02
Product name: PCSK4 MaxPab mouse polyclonal antibody (B02)
Product description: Mouse polyclonal antibody raised against a full-length human PCSK4 protein.
Gene id: 54760
Gene name: PCSK4
Gene alias: DKFZp434B217|MGC34749|PC4|SPC5
Gene description: proprotein convertase subtilisin/kexin type 4
Genbank accession: BC036354
Immunogen: PCSK4 (AAH36354, 1 a.a. ~ 242 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGTRSTLVAIRPLDVSTEGYNNWVFMSTHFWDENPQGVWTLGLENKGYYFNTGTLYRYTLLLYGTAEDMTARPTGPQVTSSACVQRDTEGLCQACDGPAYILGQLCLAYCPPRFFNHTRLVTAGPGHTAAPALRVCSSCHASCYTCRGGSPRDCTSCPPSSTLDQQQGSCMGPTTPDSRPRLRAAACPHHRCPASAMVLSLLAVTLGGPVLCGMSMDLPLYAWLSRARATPTKPQVWLPAGT
Protein accession: AAH36354
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00054760-B02-13-15-1.jpg
Application image note: Western Blot analysis of PCSK4 expression in transfected 293T cell line (H00054760-T02) by PCSK4 MaxPab polyclonal antibody.

Lane 1: PCSK4 transfected lysate(26.62 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PCSK4 MaxPab mouse polyclonal antibody (B02) now

Add to cart