IL17RD polyclonal antibody (A01) View larger

IL17RD polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL17RD polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about IL17RD polyclonal antibody (A01)

Brand: Abnova
Reference: H00054756-A01
Product name: IL17RD polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant IL17RD.
Gene id: 54756
Gene name: IL17RD
Gene alias: DKFZp434N1928|FLJ35755|IL-17RD|IL17RLM|MGC133309|SEF
Gene description: interleukin 17 receptor D
Genbank accession: NM_017563
Immunogen: IL17RD (NP_060033, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MESQPFLNMKFETDYFVKVVPFPSIKNESNYHPFFFRTRACDLLLQPDNLACKPFWKPRNLNISQHGSDMQVSFDHAPHNFGFRFFYLHYKLKHEGPFKR
Protein accession: NP_060033
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00054756-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IL17RD polyclonal antibody (A01) now

Add to cart