Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FBLIM1 monoclonal antibody (M10), clone 5E11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about FBLIM1 monoclonal antibody (M10), clone 5E11
| Brand: | Abnova |
| Reference: | H00054751-M10 |
| Product name: | FBLIM1 monoclonal antibody (M10), clone 5E11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FBLIM1. |
| Clone: | 5E11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 54751 |
| Gene name: | FBLIM1 |
| Gene alias: | CAL|DKFZp434G171|FBLP-1|FBLP1|RP11-169K16.5 |
| Gene description: | filamin binding LIM protein 1 |
| Genbank accession: | NM_017556 |
| Immunogen: | FBLIM1 (NP_060026, 270 a.a. ~ 373 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VTCARCIGDESFALGSQNEVYCLDDFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQGCYPLNNHLFCKPCHVKRSAAGCC |
| Protein accession: | NP_060026 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | FBLIM1 monoclonal antibody (M10), clone 5E11 Western Blot analysis of FBLIM1 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Kindlin-1 Is Required for RhoGTPase-Mediated Lamellipodia Formation in Keratinocytes.Has C, Herz C, Zimina E, Qu HY, He Y, Zhang ZG, Wen TT, Gache Y, Aumailley M, Bruckner-Tuderman L. Am J Pathol. 2009 Oct;175(4):1442-52. Epub 2009 Sep 17. |