RAB39 MaxPab mouse polyclonal antibody (B01) View larger

RAB39 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB39 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about RAB39 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00054734-B01
Product name: RAB39 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human RAB39 protein.
Gene id: 54734
Gene name: RAB39
Gene alias: -
Gene description: RAB39, member RAS oncogene family
Genbank accession: BC028064
Immunogen: RAB39 (AAH28064, 1 a.a. ~ 217 a.a) full-length human protein.
Immunogen sequence/protein sequence: METIWIYQFRLIVIGDSTVGKSCLLRRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTREEAEKLSADCGMKYIETSAKDATNVEESFTILTRDIYELIKKGEICIQDGWEGVKSGFVPNAVHSSEEAVKPRKECFC
Protein accession: AAH28064
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00054734-B01-13-15-1.jpg
Application image note: Western Blot analysis of RAB39 expression in transfected 293T cell line (H00054734-T01) by RAB39 MaxPab polyclonal antibody.

Lane 1: RAB39 transfected lysate(23.98 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RAB39 MaxPab mouse polyclonal antibody (B01) now

Add to cart