Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLC6A20 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about SLC6A20 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00054716-A01 |
| Product name: | SLC6A20 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SLC6A20. |
| Gene id: | 54716 |
| Gene name: | SLC6A20 |
| Gene alias: | MGC161475|SIT1|XT3|Xtrp3 |
| Gene description: | solute carrier family 6 (proline IMINO transporter), member 20 |
| Genbank accession: | NM_020208 |
| Immunogen: | SLC6A20 (NP_064593, 301 a.a. ~ 369 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | KATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSLESELDTAVQ |
| Protein accession: | NP_064593 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.7 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Human intestine luminal ACE2 and amino acid transporter expression increased by ACE-inhibitors.Vuille-dit-Bille RN, Camargo SM, Emmenegger L, Sasse T, Kummer E, Jando J, Hamie QM, Meier CF, Hunziker S, Forras-Kaufmann Z, Kuyumcu S, Fox M, Schwizer W, Fried M, Lindenmeyer M, Gotze O, Verrey F. Amino Acids. 2015 Apr;47(4):693-705. doi: 10.1007/s00726-014-1889-6. Epub 2014 Dec 23. |