RRN3 monoclonal antibody (M01), clone 3H5 View larger

RRN3 monoclonal antibody (M01), clone 3H5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RRN3 monoclonal antibody (M01), clone 3H5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about RRN3 monoclonal antibody (M01), clone 3H5

Brand: Abnova
Reference: H00054700-M01
Product name: RRN3 monoclonal antibody (M01), clone 3H5
Product description: Mouse monoclonal antibody raised against a partial recombinant RRN3.
Clone: 3H5
Isotype: IgG1 Kappa
Gene id: 54700
Gene name: RRN3
Gene alias: DKFZp566E104|MGC104238|TIFIA
Gene description: RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae)
Genbank accession: NM_018427
Immunogen: RRN3 (NP_060897, 525 a.a. ~ 631 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CYTIIERNNRQMLPVIRSTAGGDSVQICTNPLDTFFPFDPCVLKRSKKFIDPIYQVWEDMSAEELQEFKKPMKKDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHF
Protein accession: NP_060897
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00054700-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00054700-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged RRN3 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RRN3 monoclonal antibody (M01), clone 3H5 now

Add to cart