UGT1A3 monoclonal antibody (M02), clone 1C10 View larger

UGT1A3 monoclonal antibody (M02), clone 1C10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UGT1A3 monoclonal antibody (M02), clone 1C10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about UGT1A3 monoclonal antibody (M02), clone 1C10

Brand: Abnova
Reference: H00054659-M02
Product name: UGT1A3 monoclonal antibody (M02), clone 1C10
Product description: Mouse monoclonal antibody raised against a partial recombinant UGT1A3.
Clone: 1C10
Isotype: IgG2b Kappa
Gene id: 54659
Gene name: UGT1A3
Gene alias: UGT1C
Gene description: UDP glucuronosyltransferase 1 family, polypeptide A3
Genbank accession: NM_019093
Immunogen: UGT1A3 (NP_061966, 30 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KVLVVPIDGSHWLSMREVLRELHARGHQAVVLTPEVNMHIKEENFFTLTTYAISWTQDEFDRHVLGHTQLYFETEHFLKKFFRSMAMLNNMSLVYHRSCV
Protein accession: NP_061966
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00054659-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00054659-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged UGT1A3 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Coffee induces expression of glucuronosyltransferases via the aryl hydrocarbon receptor and Nrf2 in liver and stomach.Kalthoff S, Ehmer U, Freiberg N, Manns MP, Strassburg CP.
Gastroenterology. 2010 Jun 20. [Epub ahead of print]

Reviews

Buy UGT1A3 monoclonal antibody (M02), clone 1C10 now

Add to cart