Brand: | Abnova |
Reference: | H00054626-M03 |
Product name: | HES2 monoclonal antibody (M03), clone 2G6 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant HES2. |
Clone: | 2G6 |
Isotype: | IgG2a Kappa |
Gene id: | 54626 |
Gene name: | HES2 |
Gene alias: | bHLHb40 |
Gene description: | hairy and enhancer of split 2 (Drosophila) |
Genbank accession: | NM_019089 |
Immunogen: | HES2 (NP_061962, 41 a.a. ~ 114 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LPLLGRENSNCSKLEKADVLEMTVRFLQELPASSWPTAAPLPCDSYREGYSACVARLARVLPACRVLEPAVSAR |
Protein accession: | NP_061962 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.14 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |