FBXL19 monoclonal antibody (M03), clone 3C5 View larger

FBXL19 monoclonal antibody (M03), clone 3C5

H00054620-M03_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXL19 monoclonal antibody (M03), clone 3C5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about FBXL19 monoclonal antibody (M03), clone 3C5

Brand: Abnova
Reference: H00054620-M03
Product name: FBXL19 monoclonal antibody (M03), clone 3C5
Product description: Mouse monoclonal antibody raised against a partial recombinant FBXL19.
Clone: 3C5
Isotype: IgG1 Kappa
Gene id: 54620
Gene name: FBXL19
Gene alias: DKFZp434K0410|Fbl19|JHDM1C|MGC50505
Gene description: F-box and leucine-rich repeat protein 19
Genbank accession: NM_019085
Immunogen: FBXL19 (NP_061958.1, 365 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RLLDLRWIEDVKDSQLRELLLPPPDTKPGQTESRGRLQGVAELRLAGLELTDASLRLLLRHAPQLSALDLSHCAHVGDPSVHLLTAPTSPLRETLVHLNLAGCHRLTD
Protein accession: NP_061958.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00054620-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00054620-M03-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged FBXL19 is 3 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FBXL19 monoclonal antibody (M03), clone 3C5 now

Add to cart