H00054600-M04_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,IP |
Brand: | Abnova |
Reference: | H00054600-M04 |
Product name: | UGT1A9 monoclonal antibody (M04), clone 1A2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant UGT1A9. |
Clone: | 1A2 |
Isotype: | IgG2a Kappa |
Gene id: | 54600 |
Gene name: | UGT1A9 |
Gene alias: | HLUGP4|LUGP4|UDPGT|UGT1AI |
Gene description: | UDP glucuronosyltransferase 1 family, polypeptide A9 |
Genbank accession: | NM_021027 |
Immunogen: | UGT1A9 (NP_066307, 27 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMPEVSWQLGRSLNCTVKTYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYNDIFDLFFSNCRSLFKDKKLVEY |
Protein accession: | NP_066307 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoprecipitation of UGT1A9 transfected lysate using anti-UGT1A9 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with UGT1A9 MaxPab rabbit polyclonal antibody. |
Applications: | ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |