LZTFL1 monoclonal antibody (M09), clone 1B1 View larger

LZTFL1 monoclonal antibody (M09), clone 1B1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LZTFL1 monoclonal antibody (M09), clone 1B1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr,IP

More info about LZTFL1 monoclonal antibody (M09), clone 1B1

Brand: Abnova
Reference: H00054585-M09
Product name: LZTFL1 monoclonal antibody (M09), clone 1B1
Product description: Mouse monoclonal antibody raised against a partial recombinant LZTFL1.
Clone: 1B1
Isotype: IgG2a Kappa
Gene id: 54585
Gene name: LZTFL1
Gene alias: FLJ36386
Gene description: leucine zipper transcription factor-like 1
Genbank accession: BC025988
Immunogen: LZTFL1 (AAH25988.1, 39 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LKESRLVEDTFTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENQELLEQVAEFEKA
Protein accession: AAH25988.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00054585-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.65 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00054585-M09-13-15-1.jpg
Application image note: Western Blot analysis of LZTFL1 expression in transfected 293T cell line by LZTFL1 monoclonal antibody (M09), clone 1B1.

Lane 1: LZTFL1 transfected lysate(34.6 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy LZTFL1 monoclonal antibody (M09), clone 1B1 now

Add to cart