LZTFL1 polyclonal antibody (A01) View larger

LZTFL1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LZTFL1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about LZTFL1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00054585-A01
Product name: LZTFL1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant LZTFL1.
Gene id: 54585
Gene name: LZTFL1
Gene alias: FLJ36386
Gene description: leucine zipper transcription factor-like 1
Genbank accession: NM_020347
Immunogen: LZTFL1 (NP_065080, 200 a.a. ~ 299 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: KDFIKAQDLSNLENTVAALKSEFQKTLNDKTENQKSLEENLATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
Protein accession: NP_065080
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00054585-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00054585-A01-1-6-1.jpg
Application image note: LZTFL1 polyclonal antibody (A01), Lot # 061130JCS1 Western Blot analysis of LZTFL1 expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LZTFL1 polyclonal antibody (A01) now

Add to cart