Brand: | Abnova |
Reference: | H00054567-A01 |
Product name: | DLL4 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant DLL4. |
Gene id: | 54567 |
Gene name: | DLL4 |
Gene alias: | MGC126344|hdelta2 |
Gene description: | delta-like 4 (Drosophila) |
Genbank accession: | NM_019074 |
Immunogen: | DLL4 (NP_061947, 123 a.a. ~ 221 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | HAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPI |
Protein accession: | NP_061947 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | DLL4 polyclonal antibody (A01), Lot # 051103JC01 Western Blot analysis of DLL4 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |