Brand: | Abnova |
Reference: | H00054556-M13A |
Product name: | ING3 monoclonal antibody (M13A), clone 2E21 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ING3. |
Clone: | 2E21 |
Isotype: | IgG2a Kappa |
Gene id: | 54556 |
Gene name: | ING3 |
Gene alias: | Eaf4|FLJ20089|ING2|p47ING3 |
Gene description: | inhibitor of growth family, member 3 |
Genbank accession: | NM_198267 |
Immunogen: | ING3 (NP_938008, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF |
Protein accession: | NP_938008 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.86 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |