EXOSC4 monoclonal antibody (M02), clone 4F9 View larger

EXOSC4 monoclonal antibody (M02), clone 4F9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EXOSC4 monoclonal antibody (M02), clone 4F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about EXOSC4 monoclonal antibody (M02), clone 4F9

Brand: Abnova
Reference: H00054512-M02
Product name: EXOSC4 monoclonal antibody (M02), clone 4F9
Product description: Mouse monoclonal antibody raised against a partial recombinant EXOSC4.
Clone: 4F9
Isotype: IgG2a Kappa
Gene id: 54512
Gene name: EXOSC4
Gene alias: FLJ20591|RRP41|RRP41A|Rrp41p|SKI6|Ski6p|hRrp41p|p12A
Gene description: exosome component 4
Genbank accession: NM_019037
Immunogen: EXOSC4 (NP_061910.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMG
Protein accession: NP_061910.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00054512-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00054512-M02-13-15-1.jpg
Application image note: Western Blot analysis of EXOSC4 expression in transfected 293T cell line by EXOSC4 monoclonal antibody (M02), clone 4F9.

Lane 1: EXOSC4 transfected lysate(26.4 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy EXOSC4 monoclonal antibody (M02), clone 4F9 now

Add to cart