Cart 205 Product Products 77 180,36 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x CAF-1 p150...259,07 € -
-
-
1 x Angptl1...259,07 € -
-
-
-
-
-
-
-
1 x IGSF4C...259,07 € -
-
-
-
-
-
-
-
-
-
1 x Ang-1...259,07 € -
1 x Transferri...259,07 € -
-
-
-
1 x Inhibin...259,07 € -
1 x CYP11A1...259,07 € -
-
-
-
1 x SH3TC1...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x HuB/D...259,07 € -
-
-
-
-
1 x BAGE2...259,07 € -
-
-
-
-
-
-
-
1 x DRP1...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Myp...259,07 € -
-
-
-
-
-
-
-
-
-
-
1 x CSGlcA-T...259,07 € -
-
-
-
-
-
-
-
-
1 x DREAM...259,07 € -
-
-
-
1 x Mouse...290,00 € -
-
-
-
-
1 x BAGE3...259,07 € -
-
1 x CYP4B1...259,07 € -
-
-
1 x MYPT1...259,07 € -
1 x MDA-7...259,07 € -
-
1 x PARP-2...259,07 € -
-
-
-
-
-
-
-
-
1 x DNA Ligase...259,07 € -
-
-
-
1 x Endo180...259,07 € -
-
-
-
-
1 x CLC-4...259,07 € -
1 x p140Cap...259,07 € -
-
-
-
-
-
1 x MSK1...259,07 € -
-
-
-
-
-
1 x LEKTI...259,07 € -
-
-
-
-
-
-
-
-
1 x Met...259,07 € -
1 x Manic...259,07 € -
-
-
-
-
-
-
-
1 x UBN-1...259,07 € -
-
-
-
-
-
1 x DMPK...259,07 € -
1 x NLE1...259,07 € -
1 x Claudin-5...259,07 € -
-
-
-
-
-
-
-
-
-
1 x p15...259,07 € -
1 x NTE...259,07 € -
1 x SR-2C...259,07 € -
-
-
-
No products
To be determined Shipping
77 180,36 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 205 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 77 180,36 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 77 180,36 €
Data sheet of FAM64A purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about FAM64A purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00054478-D01P |
| Product name: | FAM64A purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human FAM64A protein. |
| Gene id: | 54478 |
| Gene name: | FAM64A |
| Gene alias: | FLJ10156|FLJ10491 |
| Gene description: | family with sequence similarity 64, member A |
| Genbank accession: | BC005004.1 |
| Immunogen: | FAM64A (AAH05004.1, 1 a.a. ~ 248 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MASRWQNMGTSVRRRSLQHQEQLEDSKELQPVVSHQETSVGALGSLCRQFQRRLPLRAVNLNLRAGPSWKRLETPEPGQQGLQAAARSAKSALGAVSQRIQESCQSGTKWLVETQVKARRRKRGAQKGSGSPTHSLSQKSTRLSGAAPAHSAADPWEKEHHRLSVRMGSHAHPLRRSRREAAFRSPYSSTEPLCSPSESDSDLEPVGAGIQHLQKLSQELDEAIMAEERKQALSDRQGFILKDVYASP |
| Protein accession: | AAH05004.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of FAM64A expression in transfected 293T cell line (H00054478-T02) by FAM64A MaxPab polyclonal antibody. Lane 1: FAM64A transfected lysate(27.39 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |