Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TAF7L monoclonal antibody (M04), clone 3E10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about TAF7L monoclonal antibody (M04), clone 3E10
| Brand: | Abnova |
| Reference: | H00054457-M04 |
| Product name: | TAF7L monoclonal antibody (M04), clone 3E10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TAF7L. |
| Clone: | 3E10 |
| Isotype: | IgG2b Kappa |
| Gene id: | 54457 |
| Gene name: | TAF7L |
| Gene alias: | FLJ23157|TAF2Q|dJ738A13.1 |
| Gene description: | TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa |
| Genbank accession: | NM_024885 |
| Immunogen: | TAF7L (NP_079161.2, 231 a.a. ~ 332 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KKRFRKTQKKVPDVKEMEKSSFTEYIESPDVENEVKRLLRSDAEAVSTRWEVIAEDGTKEIESQGSIPGFLISSGMSSHKQGHTSSEYDMLREMFSDSRSNN |
| Protein accession: | NP_079161.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.96 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged TAF7L is 0.03 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |