Brand: | Abnova |
Reference: | H00054453-M04 |
Product name: | RIN2 monoclonal antibody (M04), clone 1E6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RIN2. |
Clone: | 1E6 |
Isotype: | IgG2a Kappa |
Gene id: | 54453 |
Gene name: | RIN2 |
Gene alias: | RASSF4 |
Gene description: | Ras and Rab interactor 2 |
Genbank accession: | NM_018993 |
Immunogen: | RIN2 (NP_061866, 786 a.a. ~ 894 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DFQNYLRVAFQEVNSGCTGKTLLVRPYITTEDVCQICAEKFKVGDPEEYSLFLFVDETWQQLAEDTYPQKIKAELHSRPQPHIFHFVYKRIKNDPYGIIFQNGEEDLTT |
Protein accession: | NP_061866 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | RIN2 monoclonal antibody (M04), clone 1E6. Western Blot analysis of RIN2 expression in Y-79 ( Cat # L042V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |