GNG2 monoclonal antibody (M03), clone 4C8 View larger

GNG2 monoclonal antibody (M03), clone 4C8

H00054331-M03_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GNG2 monoclonal antibody (M03), clone 4C8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about GNG2 monoclonal antibody (M03), clone 4C8

Brand: Abnova
Reference: H00054331-M03
Product name: GNG2 monoclonal antibody (M03), clone 4C8
Product description: Mouse monoclonal antibody raised against a full length recombinant GNG2.
Clone: 4C8
Isotype: IgG1 Kappa
Gene id: 54331
Gene name: GNG2
Gene alias: -
Gene description: guanine nucleotide binding protein (G protein), gamma 2
Genbank accession: BC020774
Immunogen: GNG2 (AAH20774, 1 a.a. ~ 71 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL
Protein accession: AAH20774
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00054331-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.55 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00054331-M03-13-15-1.jpg
Application image note: Western Blot analysis of GNG2 expression in transfected 293T cell line by GNG2 monoclonal antibody (M03), clone 4C8.

Lane 1: GNG2 transfected lysate(7.9 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GNG2 monoclonal antibody (M03), clone 4C8 now

Add to cart