Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DCUN1D1 monoclonal antibody (M02), clone 4B5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about DCUN1D1 monoclonal antibody (M02), clone 4B5
| Brand: | Abnova |
| Reference: | H00054165-M02 |
| Product name: | DCUN1D1 monoclonal antibody (M02), clone 4B5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DCUN1D1. |
| Clone: | 4B5 |
| Isotype: | IgG2b Kappa |
| Gene id: | 54165 |
| Gene name: | DCUN1D1 |
| Gene alias: | DCUN1L1|RP42|SCCRO|SCRO|Tes3 |
| Gene description: | DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) |
| Genbank accession: | NM_020640 |
| Immunogen: | DCUN1D1 (NP_065691, 1 a.a. ~ 89 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQF |
| Protein accession: | NP_065691 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | DCUN1D1 monoclonal antibody (M02), clone 4B5. Western Blot analysis of DCUN1D1 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |