DCUN1D1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

DCUN1D1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DCUN1D1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about DCUN1D1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00054165-D01P
Product name: DCUN1D1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human DCUN1D1 protein.
Gene id: 54165
Gene name: DCUN1D1
Gene alias: DCUN1L1|RP42|SCCRO|SCRO|Tes3
Gene description: DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae)
Genbank accession: NM_020640.2
Immunogen: DCUN1D1 (NP_065691.2, 1 a.a. ~ 259 a.a) full-length human protein.
Immunogen sequence/protein sequence: MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV
Protein accession: NP_065691.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00054165-D01P-2-C2-1.jpg
Application image note: DCUN1D1 MaxPab rabbit polyclonal antibody. Western Blot analysis of DCUN1D1 expression in mouse liver.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DCUN1D1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart