CHRAC1 polyclonal antibody (A02) View larger

CHRAC1 polyclonal antibody (A02)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHRAC1 polyclonal antibody (A02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CHRAC1 polyclonal antibody (A02)

Brand: Abnova
Reference: H00054108-A02
Product name: CHRAC1 polyclonal antibody (A02)
Product description: Mouse polyclonal antibody raised against a partial recombinant CHRAC1.
Gene id: 54108
Gene name: CHRAC1
Gene alias: CHARC1|CHARC15|CHRAC15|YCL1
Gene description: chromatin accessibility complex 1
Genbank accession: NM_017444
Immunogen: CHRAC1 (NP_059140, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPK
Protein accession: NP_059140
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00054108-A02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.67 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CHRAC1 polyclonal antibody (A02) now

Add to cart