POLE3 purified MaxPab rabbit polyclonal antibody (D01P) View larger

POLE3 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of POLE3 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about POLE3 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00054107-D01P
Product name: POLE3 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human POLE3 protein.
Gene id: 54107
Gene name: POLE3
Gene alias: CHARAC17|CHRAC17|YBL1|p17
Gene description: polymerase (DNA directed), epsilon 3 (p17 subunit)
Genbank accession: BC003166
Immunogen: POLE3 (AAH03166.1, 1 a.a. ~ 147 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN
Protein accession: AAH03166.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00054107-D01P-13-15-1.jpg
Application image note: Western Blot analysis of POLE3 expression in transfected 293T cell line (H00054107-T02) by POLE3 MaxPab polyclonal antibody.

Lane 1: POLE3 transfected lysate(16.90 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy POLE3 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart