Brand: | Abnova |
Reference: | H00054107-A01 |
Product name: | POLE3 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant POLE3. |
Gene id: | 54107 |
Gene name: | POLE3 |
Gene alias: | CHARAC17|CHRAC17|YBL1|p17 |
Gene description: | polymerase (DNA directed), epsilon 3 (p17 subunit) |
Genbank accession: | BC003166 |
Immunogen: | POLE3 (AAH03166, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN |
Protein accession: | AAH03166 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |