Brand: | Abnova |
Reference: | H00054106-M14 |
Product name: | TLR9 monoclonal antibody (M14), clone 2C3 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant TLR9. |
Clone: | 2C3 |
Isotype: | IgG2a Kappa |
Gene id: | 54106 |
Gene name: | TLR9 |
Gene alias: | CD289 |
Gene description: | toll-like receptor 9 |
Genbank accession: | NM_017442 |
Immunogen: | TLR9 (NP_059138, 370 a.a. ~ 473 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DMHGIFFRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYVDLSDNRISGASELTATMGEADGGEKVWLQPGDLAPAPVDTPSSEDFRPNCSTL |
Protein accession: | NP_059138 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.44 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |