TLR9 monoclonal antibody (M14), clone 2C3 View larger

TLR9 monoclonal antibody (M14), clone 2C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TLR9 monoclonal antibody (M14), clone 2C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TLR9 monoclonal antibody (M14), clone 2C3

Brand: Abnova
Reference: H00054106-M14
Product name: TLR9 monoclonal antibody (M14), clone 2C3
Product description: Mouse monoclonal antibody raised against a full length recombinant TLR9.
Clone: 2C3
Isotype: IgG2a Kappa
Gene id: 54106
Gene name: TLR9
Gene alias: CD289
Gene description: toll-like receptor 9
Genbank accession: NM_017442
Immunogen: TLR9 (NP_059138, 370 a.a. ~ 473 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DMHGIFFRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYVDLSDNRISGASELTATMGEADGGEKVWLQPGDLAPAPVDTPSSEDFRPNCSTL
Protein accession: NP_059138
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00054106-M14-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.44 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TLR9 monoclonal antibody (M14), clone 2C3 now

Add to cart