TLR9 monoclonal antibody (M04), clone 3B7 View larger

TLR9 monoclonal antibody (M04), clone 3B7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TLR9 monoclonal antibody (M04), clone 3B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA

More info about TLR9 monoclonal antibody (M04), clone 3B7

Brand: Abnova
Reference: H00054106-M04
Product name: TLR9 monoclonal antibody (M04), clone 3B7
Product description: Mouse monoclonal antibody raised against a partial recombinant TLR9.
Clone: 3B7
Isotype: IgG2a Kappa
Gene id: 54106
Gene name: TLR9
Gene alias: CD289
Gene description: toll-like receptor 9
Genbank accession: BC032713
Immunogen: TLR9 (AAH32713, 99 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PPVGLSPMHFPCHMTIEPSTFLAVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYYKNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVP
Protein accession: AAH32713
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00054106-M04-1-8-1.jpg
Application image note: TLR9 monoclonal antibody (M04), clone 3B7 Western Blot analysis of TLR9 expression in NIH/3T3 ( Cat # L018V1 ).
Applications: WB-Ce,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy TLR9 monoclonal antibody (M04), clone 3B7 now

Add to cart