Brand: | Abnova |
Reference: | H00054106-M02 |
Product name: | TLR9 monoclonal antibody (M02), clone 1F4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TLR9. |
Clone: | 1F4 |
Isotype: | IgG2a Kappa |
Gene id: | 54106 |
Gene name: | TLR9 |
Gene alias: | CD289 |
Gene description: | toll-like receptor 9 |
Genbank accession: | BC032713 |
Immunogen: | TLR9 (AAH32713, 99 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PPVGLSPMHFPCHMTIEPSTFLAVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYYKNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVP |
Protein accession: | AAH32713 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TLR9 monoclonal antibody (M02), clone 1F4 Western Blot analysis of TLR9 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA |
Shipping condition: | Dry Ice |