RIPK4 monoclonal antibody (M03), clone 3B1 View larger

RIPK4 monoclonal antibody (M03), clone 3B1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RIPK4 monoclonal antibody (M03), clone 3B1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about RIPK4 monoclonal antibody (M03), clone 3B1

Brand: Abnova
Reference: H00054101-M03
Product name: RIPK4 monoclonal antibody (M03), clone 3B1
Product description: Mouse monoclonal antibody raised against a partial recombinant RIPK4.
Clone: 3B1
Isotype: IgG1 Kappa
Gene id: 54101
Gene name: RIPK4
Gene alias: ANKK2|ANKRD3|DIK|MGC129992|MGC129993|PKK|RIP4
Gene description: receptor-interacting serine-threonine kinase 4
Genbank accession: NM_020639
Immunogen: RIPK4 (NP_065690, 675 a.a. ~ 784 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEELVSADVIDLFDEQGLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSKT
Protein accession: NP_065690
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00054101-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00054101-M03-1-12-1.jpg
Application image note: RIPK4 monoclonal antibody (M03), clone 3B1 Western Blot analysis of RIPK4 expression in HepG2 ( Cat # L019V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RIPK4 monoclonal antibody (M03), clone 3B1 now

Add to cart