CPSF2 polyclonal antibody (A01) View larger

CPSF2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CPSF2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about CPSF2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00053981-A01
Product name: CPSF2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CPSF2.
Gene id: 53981
Gene name: CPSF2
Gene alias: CPSF100|KIAA1367
Gene description: cleavage and polyadenylation specific factor 2, 100kDa
Genbank accession: NM_017437
Immunogen: CPSF2 (NP_059133, 683 a.a. ~ 782 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: FGDDEKETGEESEIIPTLEPLPPHEVPGHQSVFMNEPRLSDFKQVLLREGIQAEFVGGVLVCNNQVAVRRTETGRIGLEGCLCQDFYRIRDLLYEQYAIV
Protein accession: NP_059133
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00053981-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00053981-A01-1-34-1.jpg
Application image note: CPSF2 polyclonal antibody (A01), Lot # 061101JCS1 Western Blot analysis of CPSF2 expression in SJCRH30 ( Cat # L027V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CPSF2 polyclonal antibody (A01) now

Add to cart