Brand: | Abnova |
Reference: | H00053981-A01 |
Product name: | CPSF2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant CPSF2. |
Gene id: | 53981 |
Gene name: | CPSF2 |
Gene alias: | CPSF100|KIAA1367 |
Gene description: | cleavage and polyadenylation specific factor 2, 100kDa |
Genbank accession: | NM_017437 |
Immunogen: | CPSF2 (NP_059133, 683 a.a. ~ 782 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | FGDDEKETGEESEIIPTLEPLPPHEVPGHQSVFMNEPRLSDFKQVLLREGIQAEFVGGVLVCNNQVAVRRTETGRIGLEGCLCQDFYRIRDLLYEQYAIV |
Protein accession: | NP_059133 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CPSF2 polyclonal antibody (A01), Lot # 061101JCS1 Western Blot analysis of CPSF2 expression in SJCRH30 ( Cat # L027V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |