CSNK1G1 monoclonal antibody (M01), clone 3D1 View larger

CSNK1G1 monoclonal antibody (M01), clone 3D1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CSNK1G1 monoclonal antibody (M01), clone 3D1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr

More info about CSNK1G1 monoclonal antibody (M01), clone 3D1

Brand: Abnova
Reference: H00053944-M01
Product name: CSNK1G1 monoclonal antibody (M01), clone 3D1
Product description: Mouse monoclonal antibody raised against a partial recombinant CSNK1G1.
Clone: 3D1
Isotype: IgG3 Kappa
Gene id: 53944
Gene name: CSNK1G1
Gene alias: -
Gene description: casein kinase 1, gamma 1
Genbank accession: BC017236
Immunogen: CSNK1G1 (AAH17236, 293 a.a. ~ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKT
Protein accession: AAH17236
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00053944-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00053944-M01-3-36-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to CSNK1G1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CSNK1G1 monoclonal antibody (M01), clone 3D1 now

Add to cart