GPR84 monoclonal antibody (M02), clone 5B7 View larger

GPR84 monoclonal antibody (M02), clone 5B7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GPR84 monoclonal antibody (M02), clone 5B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GPR84 monoclonal antibody (M02), clone 5B7

Brand: Abnova
Reference: H00053831-M02
Product name: GPR84 monoclonal antibody (M02), clone 5B7
Product description: Mouse monoclonal antibody raised against a partial recombinant GPR84.
Clone: 5B7
Isotype: IgG1 Kappa
Gene id: 53831
Gene name: GPR84
Gene alias: EX33|GPCR4
Gene description: G protein-coupled receptor 84
Genbank accession: NM_020370
Immunogen: GPR84 (NP_065103, 208 a.a. ~ 316 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGK
Protein accession: NP_065103
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00053831-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00053831-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged GPR84 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GPR84 monoclonal antibody (M02), clone 5B7 now

Add to cart