Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CLIC5 monoclonal antibody (M03), clone 1E6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,ELISA,WB-Re |
More info about CLIC5 monoclonal antibody (M03), clone 1E6
| Brand: | Abnova |
| Reference: | H00053405-M03 |
| Product name: | CLIC5 monoclonal antibody (M03), clone 1E6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CLIC5. |
| Clone: | 1E6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 53405 |
| Gene name: | CLIC5 |
| Gene alias: | CLIC5B|FLJ90663|MST130|MSTP130|dJ447E21.4 |
| Gene description: | chloride intracellular channel 5 |
| Genbank accession: | NM_016929 |
| Immunogen: | CLIC5 (NP_058625.2, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLP |
| Protein accession: | NP_058625.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to CLIC5 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | CLIC5A, a component of the ezrin-podocalyxin complex in glomeruli, is a determinant of podocyte integrity.Wegner B, Al-Momany A, Kulak SC, Kozlowski K, Obeidat M, Jahroudi N, Paes J, Berryman M, Ballermann BJ. Am J Physiol Renal Physiol. 2010 Mar 24. [Epub ahead of print] |