LRP1B polyclonal antibody (A01) View larger

LRP1B polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LRP1B polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about LRP1B polyclonal antibody (A01)

Brand: Abnova
Reference: H00053353-A01
Product name: LRP1B polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant LRP1B.
Gene id: 53353
Gene name: LRP1B
Gene alias: LRP-DIT|LRPDIT
Gene description: low density lipoprotein-related protein 1B (deleted in tumors)
Genbank accession: NM_018557
Immunogen: LRP1B (NP_061027, 111 a.a. ~ 200 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: VHCQELLSNCQQLNCQYKCTMVRNSTRCYCEDGFEITEDGRSCKDQDECAVYGTCSQTCRNTHGSYTCSCVEGYLMQPDNRSCKAKIEPT
Protein accession: NP_061027
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00053353-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.01 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LRP1B polyclonal antibody (A01) now

Add to cart