SPA17 monoclonal antibody (M03), clone 3B6 View larger

SPA17 monoclonal antibody (M03), clone 3B6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPA17 monoclonal antibody (M03), clone 3B6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about SPA17 monoclonal antibody (M03), clone 3B6

Brand: Abnova
Reference: H00053340-M03
Product name: SPA17 monoclonal antibody (M03), clone 3B6
Product description: Mouse monoclonal antibody raised against a partial recombinant SPA17.
Clone: 3B6
Isotype: IgG2a Kappa
Gene id: 53340
Gene name: SPA17
Gene alias: SP17|SP17-1
Gene description: sperm autoantigenic protein 17
Genbank accession: NM_017425
Immunogen: SPA17 (NP_059121, 51 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEE
Protein accession: NP_059121
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00053340-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00053340-M03-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged SPA17 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SPA17 monoclonal antibody (M03), clone 3B6 now

Add to cart