BTBD1 monoclonal antibody (M01), clone 3E11 View larger

BTBD1 monoclonal antibody (M01), clone 3E11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BTBD1 monoclonal antibody (M01), clone 3E11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about BTBD1 monoclonal antibody (M01), clone 3E11

Brand: Abnova
Reference: H00053339-M01
Product name: BTBD1 monoclonal antibody (M01), clone 3E11
Product description: Mouse monoclonal antibody raised against a partial recombinant BTBD1.
Clone: 3E11
Isotype: IgG2a Kappa
Gene id: 53339
Gene name: BTBD1
Gene alias: C15orf1|NS5ATP8
Gene description: BTB (POZ) domain containing 1
Genbank accession: NM_025238
Immunogen: BTBD1 (NP_079514, 384 a.a. ~ 482 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EYEKKQTLGQNDTGFSCDGTANTFRVMFKEPIEILPNVCYTACATLKGPDSHYGTKGLKKVVHETPAASKTVFFFFSSPGNNNGTSIEDGQIPEIIFYT
Protein accession: NP_079514
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00053339-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00053339-M01-1-1-1.jpg
Application image note: BTBD1 monoclonal antibody (M01), clone 3E11 Western Blot analysis of BTBD1 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy BTBD1 monoclonal antibody (M01), clone 3E11 now

Add to cart