CECR1 monoclonal antibody (M01), clone 3D11 View larger

CECR1 monoclonal antibody (M01), clone 3D11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CECR1 monoclonal antibody (M01), clone 3D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,IP

More info about CECR1 monoclonal antibody (M01), clone 3D11

Brand: Abnova
Reference: H00051816-M01
Product name: CECR1 monoclonal antibody (M01), clone 3D11
Product description: Mouse monoclonal antibody raised against a partial recombinant CECR1.
Clone: 3D11
Isotype: IgG2a Kappa
Gene id: 51816
Gene name: CECR1
Gene alias: ADGF|IDGFL
Gene description: cat eye syndrome chromosome region, candidate 1
Genbank accession: NM_017424
Immunogen: CECR1 (NP_059120.2, 402 a.a. ~ 511 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAKGLSYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWKKRWDKFIADVATK
Protein accession: NP_059120.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051816-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051816-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged CECR1 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,IP
Shipping condition: Dry Ice

Reviews

Buy CECR1 monoclonal antibody (M01), clone 3D11 now

Add to cart