Brand: | Abnova |
Reference: | H00051809-A01 |
Product name: | GALNT7 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant GALNT7. |
Gene id: | 51809 |
Gene name: | GALNT7 |
Gene alias: | GALNAC-T7|GalNAcT7 |
Gene description: | UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 7 (GalNAc-T7) |
Genbank accession: | NM_017423 |
Immunogen: | GALNT7 (NP_059119, 559 a.a. ~ 657 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | LGPCHRMGGNQLFRINEANQLMQYDQCLTKGADGSKVMITHCNLNEFKEWQYFKNLHRFTHIPSGKCLDRSEVLHQVFISNCDSSKTTQKWEMNNIHSV |
Protein accession: | NP_059119 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | MicroRNA miR-378 Regulates Nephronectin Expression Modulating Osteoblast Differentiation by Targeting GalNT-7.Kahai S, Lee SC, Lee DY, Yang J, Li M, Wang CH, Jiang Z, Zhang Y, Peng C, Yang BB. PLoS One. 2009 Oct 21;4(10):e7535. |