Brand: | Abnova |
Reference: | H00051804-M08 |
Product name: | SIX4 monoclonal antibody (M08), clone 5D4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SIX4. |
Clone: | 5D4 |
Isotype: | IgG1 Kappa |
Gene id: | 51804 |
Gene name: | SIX4 |
Gene alias: | AREC3|MGC119450|MGC119452|MGC119453 |
Gene description: | SIX homeobox 4 |
Genbank accession: | NM_017420 |
Immunogen: | SIX4 (NP_059116, 672 a.a. ~ 780 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GQDLLSVPMTQAALGEIVPTAEDQVGHPSPAVHQDFVQEHRLVLQSVANMKENFLSNSESKATSSLMMLDSKSKYVLDGMVDTVCEDLETDKKELAKLQTVQLDEDMQD |
Protein accession: | NP_059116 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SIX4 monoclonal antibody (M08), clone 5D4 Western Blot analysis of SIX4 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |