ZAK monoclonal antibody (M09), clone 2G7 View larger

ZAK monoclonal antibody (M09), clone 2G7

H00051776-M09_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZAK monoclonal antibody (M09), clone 2G7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about ZAK monoclonal antibody (M09), clone 2G7

Brand: Abnova
Reference: H00051776-M09
Product name: ZAK monoclonal antibody (M09), clone 2G7
Product description: Mouse monoclonal antibody raised against a partial recombinant ZAK.
Clone: 2G7
Isotype: IgG2a Kappa
Gene id: 51776
Gene name: ZAK
Gene alias: AZK|MLK7|MLT|MLTK|MRK|mlklak
Gene description: sterile alpha motif and leucine zipper containing kinase AZK
Genbank accession: BC001401
Immunogen: ZAK (AAH01401, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHY
Protein accession: AAH01401
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051776-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.83 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051776-M09-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to ZAK on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZAK monoclonal antibody (M09), clone 2G7 now

Add to cart