ZAK monoclonal antibody (M07A), clone 4C4 View larger

ZAK monoclonal antibody (M07A), clone 4C4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZAK monoclonal antibody (M07A), clone 4C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ZAK monoclonal antibody (M07A), clone 4C4

Brand: Abnova
Reference: H00051776-M07A
Product name: ZAK monoclonal antibody (M07A), clone 4C4
Product description: Mouse monoclonal antibody raised against a partial recombinant ZAK.
Clone: 4C4
Isotype: IgG2a Kappa
Gene id: 51776
Gene name: ZAK
Gene alias: AZK|MLK7|MLT|MLTK|MRK|mlklak
Gene description: sterile alpha motif and leucine zipper containing kinase AZK
Genbank accession: BC001401
Immunogen: ZAK (AAH01401, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHY
Protein accession: AAH01401
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051776-M07A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.83 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZAK monoclonal antibody (M07A), clone 4C4 now

Add to cart