Brand: | Abnova |
Reference: | H00051776-M03A |
Product name: | ZAK monoclonal antibody (M03A), clone 3G5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZAK. |
Clone: | 3G5 |
Isotype: | IgG2a Kappa |
Gene id: | 51776 |
Gene name: | ZAK |
Gene alias: | AZK|MLK7|MLT|MLTK|MRK|mlklak |
Gene description: | sterile alpha motif and leucine zipper containing kinase AZK |
Genbank accession: | BC001401 |
Immunogen: | ZAK (AAH01401, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHY |
Protein accession: | AAH01401 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.83 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |