Brand: | Abnova |
Reference: | H00051765-M03 |
Product name: | RP6-213H19.1 monoclonal antibody (M03), clone 3G5 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant RP6-213H19.1. |
Clone: | 3G5 |
Isotype: | IgG1 Kappa |
Gene id: | 51765 |
Gene name: | RP6-213H19.1 |
Gene alias: | MASK|MST4 |
Gene description: | serine/threonine protein kinase MST4 |
Genbank accession: | BC017213 |
Immunogen: | RP6-213H19.1 (AAH17213, 1 a.a. ~ 137 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRALPPYERSLIQRKYRMGQSKILCKP |
Protein accession: | AAH17213 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (40.81 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to RP6-213H19.1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |