RP6-213H19.1 polyclonal antibody (A01) View larger

RP6-213H19.1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RP6-213H19.1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about RP6-213H19.1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00051765-A01
Product name: RP6-213H19.1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant RP6-213H19.1.
Gene id: 51765
Gene name: RP6-213H19.1
Gene alias: MASK|MST4
Gene description: serine/threonine protein kinase MST4
Genbank accession: NM_016542
Immunogen: RP6-213H19.1 (NP_057626, 331 a.a. ~ 415 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: KKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADES
Protein accession: NP_057626
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051765-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.46 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RP6-213H19.1 polyclonal antibody (A01) now

Add to cart