Brand: | Abnova |
Reference: | H00051762-M01 |
Product name: | RAB8B monoclonal antibody (M01), clone 1E4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RAB8B. |
Clone: | 1E4 |
Isotype: | IgG2b Kappa |
Gene id: | 51762 |
Gene name: | RAB8B |
Gene alias: | FLJ38125 |
Gene description: | RAB8B, member RAS oncogene family |
Genbank accession: | NM_016530 |
Immunogen: | RAB8B (NP_057614.1, 101 a.a. ~ 207 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL |
Protein accession: | NP_057614.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged RAB8B is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |