CRKRS monoclonal antibody (M02A), clone 2F6 View larger

CRKRS monoclonal antibody (M02A), clone 2F6

H00051755-M02A_200uL

New product

395,00 € tax excl.

200 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CRKRS monoclonal antibody (M02A), clone 2F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about CRKRS monoclonal antibody (M02A), clone 2F6

Brand: Abnova
Reference: H00051755-M02A
Product name: CRKRS monoclonal antibody (M02A), clone 2F6
Product description: Mouse monoclonal antibody raised against a partial recombinant CRKRS.
Clone: 2F6
Isotype: IgG1 Kappa
Gene id: 51755
Gene name: CRKRS
Gene alias: CRK7|CRKR|KIAA0904
Gene description: Cdc2-related kinase, arginine/serine-rich
Genbank accession: NM_016507
Immunogen: CRKRS (NP_057591, 1281 a.a. ~ 1380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGHLPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESLVQTLVKNRTFSGSL
Protein accession: NP_057591
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051755-M02A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051755-M02A-1-25-1.jpg
Application image note: CRKRS monoclonal antibody (M02A), clone 2F6 Western Blot analysis of CRKRS expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CRKRS monoclonal antibody (M02A), clone 2F6 now

Add to cart