C9orf127 MaxPab mouse polyclonal antibody (B01) View larger

C9orf127 MaxPab mouse polyclonal antibody (B01)

H00051754-B01_50uL

New product

395,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C9orf127 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ti,IF,WB-Tr

More info about C9orf127 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00051754-B01
Product name: C9orf127 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human C9orf127 protein.
Gene id: 51754
Gene name: C9orf127
Gene alias: MGC120460|NAG-5|NGX6|RP11-112J3.10
Gene description: chromosome 9 open reading frame 127
Genbank accession: BC041377.1
Immunogen: C9orf127 (AAH41377.1, 1 a.a. ~ 257 a.a) full-length human protein.
Immunogen sequence/protein sequence: MWRPHFHTCPPQSSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLSVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVRMRTFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTVCGGVCILSLGACAWWWVTVCISTTFSEGLGMSVPSLCLLQTETAVLPKLSCIDNGHFCKTHWSK
Protein accession: AAH41377.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00051754-B01-13-15-1.jpg
Application image note: Western Blot analysis of C9orf127 expression in transfected 293T cell line (H00051754-T01) by C9orf127 MaxPab polyclonal antibody.

Lane 1: C9orf127 transfected lysate(28.27 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C9orf127 MaxPab mouse polyclonal antibody (B01) now

Add to cart