H00051754-B01_50uL
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ti,IF,WB-Tr |
Brand: | Abnova |
Reference: | H00051754-B01 |
Product name: | C9orf127 MaxPab mouse polyclonal antibody (B01) |
Product description: | Mouse polyclonal antibody raised against a full-length human C9orf127 protein. |
Gene id: | 51754 |
Gene name: | C9orf127 |
Gene alias: | MGC120460|NAG-5|NGX6|RP11-112J3.10 |
Gene description: | chromosome 9 open reading frame 127 |
Genbank accession: | BC041377.1 |
Immunogen: | C9orf127 (AAH41377.1, 1 a.a. ~ 257 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MWRPHFHTCPPQSSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLSVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVRMRTFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTVCGGVCILSLGACAWWWVTVCISTTFSEGLGMSVPSLCLLQTETAVLPKLSCIDNGHFCKTHWSK |
Protein accession: | AAH41377.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | Western Blot analysis of C9orf127 expression in transfected 293T cell line (H00051754-T01) by C9orf127 MaxPab polyclonal antibody. Lane 1: C9orf127 transfected lysate(28.27 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,IF,WB-Tr |
Shipping condition: | Dry Ice |