Brand: | Abnova |
Reference: | H00051738-M09 |
Product name: | GHRL monoclonal antibody (M09), clone 4B8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant GHRL. |
Clone: | 4B8 |
Isotype: | IgG2a Kappa |
Gene id: | 51738 |
Gene name: | GHRL |
Gene alias: | MTLRP|obestatin |
Gene description: | ghrelin/obestatin prepropeptide |
Genbank accession: | BC025791 |
Immunogen: | GHRL (AAH25791.1, 1 a.a. ~ 117 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK |
Protein accession: | AAH25791.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.61 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to GHRL on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |